Biotechnology GATE Exam Question Paper Indian Institute of Science Bangalore : iisc.ernet.in
Name of the University : Indian Institute of Science Bangalore
Degree : Engineering
Exam : GATE Exam
Document Type : Model Question Paper
Name of the Subject : Biotechnology
Website : iisc.ernet.in
Download Sample Question Paper : https://www.pdfquestion.in/uploads/7663-BTGATE2015.pdf
Biotechnology Model Paper :
Q.1 Which one of the following complement proteins is the initiator of the membrane attack complex?
(A) C3a (B) C3b (C) C5a (D) C5b
Related : Indian Institute of Science Bangalore Electrical Engineering GATE Exam Question Paper : www.pdfquestion.in/7660.html
Q.2 Levinthal’s paradox is related to
(A) protein secretion (B) protein degradation
(C) protein folding (D) protein trafficking
Q.3 Which one of the following is a second generation genetically engineered crop?
(A) Bt brinjal (B) Roundup soyabean
(C) Golden rice (D) Bt rice
Q.4 Based on the heavy chain, which one of the following antibodies has multiple subtypes?
(A) IgM (B) IgD (C) IgE (D) IgG
Q.5 The cytokinetic organelle in plant cells is
(A) centriole (B) phragmoplast (C) proplastid (D) chromoplastid
Q.6 Anergy refers to
(A) mitochondrial dysfunction (B) allergy to environmental antigens
(C) unresponsiveness to antigens (D) a state of no energy
Q.7 ABO blood group antigens in humans are differentiated from each other on the basis of
(A) sialic acid (B) lipids (C) spectrin (D) glycoproteins
Q.8 Which one of the following organisms is used for the determination of phenol coefficient of a disinfectant?
(A) Salmonella typhi (B) Escherichia coli
(C) Candida albicans (D) Bacillus psychrophilus
Q.9 A single subunit enzyme converts 420 µmoles of substrate to product in one minute. The activity of the enzyme is × 10-6 Katal.
Q.10 Which one of the following amino acids has the highest probability to be found on the surface of a typical globular protein in aqueous environment?
(A) Ala (B) Val (C) Arg (D) Ile
Q.11 Which one of the following is NOT a product of denitrification in Pseudomonas?
(A) N2 (B) N2O (C) NO2 – (D) NH4 +
Q.12 The determinant of the matrix is .
3 0 0
2 5 0
6 -8 -4
Q.13 Which one of the following features is NOT required in a prokaryotic expression vector?
(A) oriC (B) Selection marker (C) CMV promoter (D) Ribosome binding site
Q.14 Production of monoclonal antibodies by hybridoma technology requires
(A) splenocytes (B) osteocytes (C) hepatocytes (D) thymocytes
Q.15 Which one of the following is INCORRECT about a typical apoptotic cell?
(A) Phosphatidylserine is presented on the outer cell surface
(B) Cytochrome c is released from mitochondria
(C) Mitochondrial membrane potential does not change
(D) Annexin-V binds to the cell surface
Q.16 Identify the file format given below >P1; JMFD
Protein X – Homo sapiens MKALTARQQEVFDLIRDHISRTLRQQGDWL
(A) GDE (B) FASTA (C) NBRF (D) GCG
Q.17 Which one of the following relations holds true for the specific growth rate (µ) of a microorganism in the death phase?
(A) µ = 0 (B) µ < 0
(C) µ = µmax (D) 0 < µ < µmax
Q.18 How many 3-tuples are possible for the following amino acid sequence? MADCMWDISEASE
(A) 4 (B) 5 (C) 11 (D) 12
Q.19 How many different protein sequences of 100 residues can be generated using 20 standard amino acids?
(A) 100 20 (B) 100 × 20 (C) 20 100
(D) 100! × 20!
Q.20 In DNA sequencing reactions using the chain termination method, the ratio of ddNTPs to dNTPs should be
(A) 0 (B) < 1
(C) 1 (D) > 1
Q.21 Which one of the following graphs represents uncompetitive inhibition?
Q.22 Choose the appropriate pair of primers to amplify the following DNA fragment by the polymerase chain reaction (PCR).
Q.23 Consider the following infinite series 1 + r + r2 + r3 + ………. . .8
If r = 0.3, then the sum of this infinite series is _____________.
Q.24 The system of linear equations in two variables shown above will have infinite solutions, if and only if, is equal to ______________.
Q.25 The interaction between an antigen (Ag) and a single-chain antibody (Ab) was studied using Scatchard analysis. The result is shown below